Table 1 List of Hsa21 genes present in the Tc1 mouse that are expressed in adult brain.
From: Generation of a panel of antibodies against proteins encoded on human chromosome 21
Hsa21 encoded Protein | Evidence of expression in brain | Candidate regions and/or reasons for discontinuation |
|---|---|---|
HSPA13/ STCH | Ubiquitous expressed [17] | No human specific region |
NRIP1 | Expressed in mouse brain [18] and Gensat images 24262 and 24263) | No human specific region |
USP25 | Basal expression in all human tissues but high expression only in fetal brain and adult testis [19, 20] | N/A |
NCAM2 | Expression in adult human brain [21] | No human specific region |
MRPL39 | Possible region (aa 1-42 MEALAMGSRALRLWLVAPGGGIKWRFIATSSASQLSPTELTE) is putative mitochondrial targeting sequence [13] | |
JAM2 | Expression in brain restricted to vascular endothelial cells [22, 23] | N/A |
GABPA | Expression in adult mouse brain [18] | No human specific region |
ADAMTS5 | Expression in adult mouse brain restricted to Schwann cells [24] | N/A |
ADAMTS1 | Expression in adult rat brain restricted to neuron subpopulation [25] | N/A |
USP16 | 1 region used for antibody generation (see table 2). | |
CCT8/ CCTQ | No human specific region | |
BACH1 | Possible region (aa 676-716 RPPAVLPPC ARGNSEPGYARGQESQQMSTATSEQAGPAEQC R) contains a putative disulphide bond | |
GRIK1 | No human specific region | |
TIAM1 | Expression in adult mouse and human brain [18] | No human specific region |
SOD1 | Expressed in human and mouse brain | 1 region used for antibody generation (see table 2) |
CBR1 | No human specific region | |
CBR3 | Expressed in human adult brain [34] | Possible region (aa 236-242 GKDSI) similarity with mouse Hy-3 and DNA isomerase 1 |
DOPEY2/C21orf5 | Expression in cortex, cerebellum, and hippocampus in adult, widespread expression in embryonic and fetal brain [35–38] | 1 region used for antibody generation (see table 2), 2nd region (aa. 671-684 LAANDS ERKNSWEP) contains N-glycosylation site |
MORC3 | Expressed in adult human brain [21] | Possible region cross (aa 665-696 DAVILPSCVEAEAKIHETQETTDKSADDAGC) similar to mouse Btnl2 and KIF21B |
SIM2 | Long isoform expressed in adult mouse brain particularly expressed in amygdala, hippocampus and thalamus, expression in embryonic and fetal brain, short isoform not expressed in adult brain [39–41] | Possible region (long form aa 613-624 GAAPAASGLAC) predicted low antigenicity |
DSCR3/DCRA | No human specific region | |
DYRK1A | No human specific region | |
KCNJ6/GIRK2 | Expressed in subset of cells throughout mouse brain [46–48] | N/A |
ETS2 | No human specific region | |
PSMG1/DSCR2 | No human specific region | |
B3GALT5 | 1 region used for antibody generation (see table 2) | |
PCP4/PEP-19 | Expressed restricted to cerebellum and olfactory bulb in adult mouse and caudate-putamen in human [52–54] | No human specific region |
DSCAM | No human specific region | |
BACE2 | Expressed in adult mouse and human brain but at low levels [18, 57–60] | Human specific region of 396 aa isoform (aa380-396 LQCLKFPGLSQQRM) predicted low antigenicity |
UMODL1 | Expression in embryonic mouse brain restricted to olfactory and vomeronasal neurons [61] | N/A |
ABCG1 | No human specific region | |
WDR4 | Basal expression in adult tissues only high expression in fetal tissues [64] | N/A |
PKNOX1/PREP1 | No human specific region | |
CBS | Expressed in astrocytes and Bergmann glial cells only in adult mouse brain [67] | N/A |
U2AF1 | No human specific region | |
CSTB | Expressed in adult mouse and human brain (astrocytes and neurons) [18, 21, 69] | No human specific region |
NNP1/RRPIB | 2 regions used for antibody generation (see table 2) | |
AGPAT3 | Expressed in adult mouse brain [71] | No human specific region |
TRAPPC1/TMEM1 | Expressed in adult human brain [21] | No human specific region |
PWP2/PWP2H | Ubiquitously expressed in human adult tissue [72] | No human specific region |
PFKL | No human specific region | |
TRPM2 | Expressed in human and mouse brain also in microglia cell lines and cultured neurons [74–77] | 1 region used for antibody generation (see table 2) |
PTTG1IP | 1 possible region (aa 1-29 MAPGVARGPTPYWRLRLGGAALLLLLIPV) putative signal sequence [14] | |
ADARB1/RED1 | 1 region used for antibody generation (see table 2) | |
FTCD | Expressed in fetal human brain and in numerous mammalian cells types [83, 84] | 2 possible human specific regions (long isoform aa 423-446 GGPTGGSEAGSLCAADAGGDGGLA and aa 465-495 PPGGQSPGDGRVWRIFQRAHQPEGHHRRGI) |
LSS | Expressed in adult mouse brain [18] | No human specific region |
S100Beta | Expression in adult mouse and human brain (particularly astrocytes and spinal, medullar, pontine and deep cerebellar neurons) [18, 21, 85] | No human specific region |
PRMT2 | No human specific region |